Sale!

wetakeprideintakingcareofeverycustomerweserveasiftheyarefamilymembershelpingpeoplelocatetheirwinnaturalswomenslivinggreenliquidgelmultivitamin70essentialnutrients0.jpg

Irwin Naturals Women’s Living Green Liquid-Gel Multi Vitamin – 70 Essential Nutrients, Full-Spectrum Vitamins, Wholefood Blend – Targeted Adrenal & Brain Support – 90 Liquid Softgels Irwin Naturals

Original price was: $ 27,99.Current price is: $ 16,79.

SKU: mode_8171928060134 Category: Supplement Tags: cf-type-supplement, cf-vendor-irwin-naturals, supplement

Description
shopping

ADVANCED DELIVERY SYSTEM – One of the world’s first multi-nutrition formulas that is delivered in a liquid softgel. Nutrients in softgels are quickly released for use in your body, easier to swallow and do not contain binders and fillers found in tablets, so there’s more room for restorative ingredients.
TARGETS WOMEN’S NEEDS – Women’s Living Green Liquid-Gel Multi sets a new standard in today’s world of low nutrition and high stress. Using powerful botanicals from whole living plants, this is not a one-size-fits-all formula…it’s targeted to benefit the unique nutritional needs of women, delivering vitamin D3, evening primrose oil, cat’s claw and cranberry.
FULL SPECTRUM BLEND – This breakthrough formula combines over 70 nutrients, full spectrum vitamins and essential minerals that cover the following 12 categories: Full Spectrum Vitamins, Minerals, Crucial Oil Complex, Antioxidant Blend, Fruit and Vegetable Blend, Immuno Blend, Amino Acid Blend, Traditional Botanical Blend, Green Super Food Blend, Adrenal Blend, Brain Blend and Targeted Blend.
MIND & BODY BLEND – Combines a whole food concentrate blend packed with essential fruits and vegetables and green super foods barley grass, spirulina and chlorella to add a boost to your diet. Along with strong herbs including ashwaganda, ginseng, and ginkgo biloba to fuel your brain.
QUALITY ASSURANCE – As a leader in innovation and research, Irwin Naturals is committed to providing outstanding, highest quality products for your health and well-being. We employ compliance testing to ensure purity and potency. Our goal is to bring you targeted formulas with ingredients at effective levels.

Fast Shipping and Professional Packing

Through our long-term relationship with UPS, FedEx, DHL and a variety of other world-class carriers, we are able to offer various shipping options. Our warehouse staff is highly skilled and will pack your items according to our precise and precise specifications. Before shipping the goods are thoroughly examined and secured. Everyday we deliver thousands of packages to customers from all over the world. Our dedication to becoming the biggest online retailer around the globe is evident by this. Warehouses and distribution centers are located in Europe as well as in the USA.

Orders that contain more than 1 item are given processing time according to each item.

We will carefully examine all items before sending. Today, most orders will be shipped within 48 hours. The estimated delivery time is between 3 and 7 days.

Returns

Due to multiple entities, including the factory and the warehouse, we're unable to fully manage stock. Therefore, the actual inventory could change at any time. It's possible that you may not receive your order after it's been placed.

Our policy is valid for a period of 30 days. If it's been more 30 days since the date you bought the item and we're unable to offer you a full refund or exchange.

The item cannot be in use and must be in the original packaging. The item must be in its original packaging.

Irwin Naturals Women’s Living Green Liquid-Gel Multi Vitamin – 70 Essential Nutrients, Full-Spectrum Vitamins, Wholefood Blend – Targeted Adrenal & Brain Support – 90 Liquid Softgels Irwin Naturals

Related products

Login